PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000147080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 210aa    MW: 23920.7 Da    PI: 9.6735
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000147080genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.16.1e-48141381128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+e++++ ++PwdLp      e+e yfFs+r++ky++g+r+nr+t+sgyWkatg dk+++s+ 
  MDP0000147080  14 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEINVCLYDPWDLPGD---LEQEKYFFSNRESKYRNGNRANRVTSSGYWKATGVDKKIVSSr 105
                    79****************************.89***************54...46799***********************************985 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    k++ vg kktLvfykg++p+ +ktdW+mhey l
  MDP0000147080 106 KNNIVGKKKTLVFYKGKSPNVSKTDWIMHEYCL 138
                    6777***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-569168IPR003441NAC domain
PROSITE profilePS5100553.73314168IPR003441NAC domain
PfamPF023654.1E-2515138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MDKFNFLRNG MSRLPPGFRF QPTDEELVFQ YLRCKVFSCP LPASIIPEIN VCLYDPWDLP  60
GDLEQEKYFF SNRESKYRNG NRANRVTSSG YWKATGVDKK IVSSRKNNIV GKKKTLVFYK  120
GKSPNVSKTD WIMHEYCLVN AETTASTHTT ENALTXKGNW VLCRVFLKKR SGKTDEEIMV  180
NYNGIRVCDN ASPVSSSSSC SSSWXVGSQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-451417317170NAC domain-containing protein 19
4dul_A7e-451417317170NAC domain-containing protein 19
1ut7_B7e-451417317170NO APICAL MERISTEM PROTEIN
1ut7_A7e-451417317170NO APICAL MERISTEM PROTEIN
1ut4_B7e-451417317170NO APICAL MERISTEM PROTEIN
1ut4_A7e-451417317170NO APICAL MERISTEM PROTEIN
3swp_D1e-441417320173NAC domain-containing protein 19
3swp_C1e-441417320173NAC domain-containing protein 19
3swp_B1e-441417320173NAC domain-containing protein 19
3swp_A1e-441417320173NAC domain-containing protein 19
3swm_D1e-441417320173NAC domain-containing protein 19
3swm_C1e-441417320173NAC domain-containing protein 19
3swm_B1e-441417320173NAC domain-containing protein 19
3swm_A1e-441417320173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392723.11e-155PREDICTED: NAC transcription factor 29-like
SwissprotQ9FY938e-79NAC83_ARATH; NAC domain-containing protein 83
TrEMBLM5WSR91e-115M5WSR9_PRUPE; Uncharacterized protein
STRINGVIT_01s0146g00280.t013e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.19e-80NAC domain containing protein 83